Synaptogyrin 3 Antibody
| Name | Synaptogyrin 3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30475 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P IP |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: KALQRFRLGTDMSLFATEQLSTGASQAYPGYPVGSGVEGTETYQSPPFTETLDTSPKGYQVP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Synaptogyrin 3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SYNGR3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: Synaptogyrin 3 Antibody [NBP2-30475] - Staining of human cerebellum shows strong positivity in neuropil in the granular layer.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/16972_Synaptogyrin-3-Antibody-Immunohistochemistry-NBP2-30475-img0001.jpg)
Immunohistochemistry: Synaptogyrin 3 Antibody [NBP2-30475] - Staining of human cerebellum shows strong positivity in neuropil in the granular layer.
![Immunoprecipitation: Synaptogyrin 3 Antibody [NBP2-30475] - IP analysis of Synaptogyrin 3 in mouse brain lysates (lane 4 using NBP2-30475). Image from verified customer review.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/16973_Synaptogyrin-3-Antibody-Immunoprecipitation-NBP2-30475-img0003.jpg)
Immunoprecipitation: Synaptogyrin 3 Antibody [NBP2-30475] - IP analysis of Synaptogyrin 3 in mouse brain lysates (lane 4 using NBP2-30475). Image from verified customer review.