CCDC28A Antibody
| Name | CCDC28A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30457 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LARLNLELYGELEELPEDKRKTASDSNLDRLLSDLEELNSSIQKLHLADAQDVPNTSA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CCDC28A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CCDC28A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: CCDC28A Antibody [NBP2-30457] - Staining of human oral mucosa shows strong cytoplasmic positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/4895_CCDC28A-Antibody-Immunohistochemistry-NBP2-30457-img0001.jpg)
Immunohistochemistry: CCDC28A Antibody [NBP2-30457] - Staining of human oral mucosa shows strong cytoplasmic positivity in squamous epithelial cells.