Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 Antibody
| Name | Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30456 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: QQRYHHTKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQVVRW |
| Description | Rabbit Polyclonal |
| Gene | HS6ST3 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 Antibody [NBP2-30456] - Immunohistochemical staining of human urinary bladder shows moderate nuclear positivity in urothelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/26820_Heparan-Sulfate-6-O-Sulfotransferase-3-HS6ST3-Antibody-Immunohistochemistry-NBP2-30456-img0001.jpg)
Immunohistochemistry: Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 Antibody [NBP2-30456] - Immunohistochemical staining of human urinary bladder shows moderate nuclear positivity in urothelial cells.