GLTSCR1 Antibody
| Name | GLTSCR1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30603 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: ASSLDADEDGPMPSRNRPPIKTYEARSRIGLKLKIKQEAGLSKVVHNTALDPVHQPPPPPATLKVA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | GLTSCR1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | GLTSCR1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: GLTSCR1 Antibody [NBP2-30603] - Staining of human cell line SiHa shows positivity in nucleus but excluded from the nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10265_GLTSCR1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30603-img0002.jpg)
![Immunohistochemistry: GLTSCR1 Antibody [NBP2-30603] - Staining of human heart muscle shows strong nuclear positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10266_GLTSCR1-Antibody-Immunohistochemistry-NBP2-30603-img0001.jpg)