PGPase Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-30549
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: DTDILLGATCGLKTILTLTGVSTLGDVKNNQESDCVSKKKMVPDFYVDSI
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: PGPase Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: PGP
• Conjugate: Unconjugated

Product images

Western Blot: PGPase Antibody [NBP2-30549] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY420860)

Immunocytochemistry/Immunofluorescence: PGPase Antibody [NBP2-30549] - Immunofluorescent staining of human cell line MCF7 shows localization to nuclear bodies.

Immunohistochemistry: PGPase Antibody [NBP2-30549] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.