Mesenteric Estrogen-Dependent Adipose 4 Antibody
| Name | Mesenteric Estrogen-Dependent Adipose 4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30667 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: GFNVFGDGLVRLDGQLYRLSSYIKRYVELTNYCDYKDYRETILSKPMLFFINVQTKKDTSKERTYAFLVNTR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Mesenteric Estrogen-Dependent Adipose 4 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MEDAG |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: Mesenteric Estrogen-Dependent Adipose 4 Antibody [NBP2-30667] - Immunohistochemical staining of human prostate shows strong cytoplasmic positivity with granular pattern in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/26917_Mesenteric-Estrogen-Dependent-Adipose-4-Antibody-Immunohistochemistry-NBP2-30667-img0001.jpg)
Immunohistochemistry: Mesenteric Estrogen-Dependent Adipose 4 Antibody [NBP2-30667] - Immunohistochemical staining of human prostate shows strong cytoplasmic positivity with granular pattern in glandular cells.