FAM107A Antibody

Name FAM107A Antibody
Supplier Novus Biologicals
Catalog NBP2-30589
Prices $129.00, $419.00
Sizes 100 µl, 25 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against a recombinant protein corresponding to amino acids: NQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEER
Purity/Format Immunogen affinity purified
Blocking Peptide FAM107A Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene FAM107A
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.