UBE2J2/UBC6 Antibody
| Name | UBE2J2/UBC6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30587 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: VFCELFPEVVEEIKQKQKAQDELSSRPQTLPLPDVVPDGETHLVQNGIQLLNGHAPGAVPNLAGLQQANRHHG |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | UBE2J2 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: UBE2J2/UBC6 Antibody [NBP2-30587] - Immunohistochemical staining of human colon shows strong cytoplasmic positivity in goblet cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/26946_UBE2J2-UBC6-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30587-img0001.jpg)
Immunocytochemistry/Immunofluorescence: UBE2J2/UBC6 Antibody [NBP2-30587] - Immunohistochemical staining of human colon shows strong cytoplasmic positivity in goblet cells.