CCDC101 Antibody
| Name | CCDC101 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30685 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: RGVLMTLLQQSAMTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEVVSYSHATN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CCDC101 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CCDC101 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: CCDC101 Antibody [NBP2-30685] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/4856_CCDC101-Antibody-Immunohistochemistry-NBP2-30685-img0001.jpg)
Immunohistochemistry: CCDC101 Antibody [NBP2-30685] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.