HHIP-Like 2 Antibody
| Name | HHIP-Like 2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30864 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: PVPVRTKSKRIPFRPLAKTVLDLLKEQSEKAARKSSSATLASGPAQGLSEKGSSKKLASPTSSKNTLRGPGTKKKAR |
| Description | Rabbit Polyclonal |
| Gene | HHIPL2 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: HHIP-Like 2 Antibody [NBP2-30864] - Immunohistochemical staining of human kidney shows distinct membranous positivity in distal tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/27039_HHIP-Like-2-Antibody-Immunohistochemistry-NBP2-30864-img0001.jpg)
Immunohistochemistry: HHIP-Like 2 Antibody [NBP2-30864] - Immunohistochemical staining of human kidney shows distinct membranous positivity in distal tubules.