LRRN4CL Antibody
| Name | LRRN4CL Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30858 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: PVLHYWLLLWDGSEAAQKGPPLNATVRRAELKGLKPGGIYVVCVVAANEAGASRVPQAGGEGLEGADIPAFGPCSRLAVPPN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | LRRN4CL Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | LRRN4CL |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: LRRN4CL Antibody [NBP2-30858] - Immunohistochemical staining of human skin shows strong cytoplasmic positivity in subset of epidermal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/27060_LRRN4CL-Antibody-Immunohistochemistry-NBP2-30858-img0001.jpg)
Immunohistochemistry: LRRN4CL Antibody [NBP2-30858] - Immunohistochemical staining of human skin shows strong cytoplasmic positivity in subset of epidermal cells.