KIAA0922 Antibody
| Name | KIAA0922 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30898 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LNCTLENGVPCVIQESAPVHNSFIDWSATCEGQFSSAYCPLELNDYNAFPEENMNYANGFPCPADVQTDFIDHNSQSTWNTPPNMPAAWGHASFISSP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | KIAA0922 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | KIAA0922 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: KIAA0922 Antibody [NBP2-30898] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli fibrillar center & vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25323_KIAA0922%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30898-img0006.jpg)
Immunocytochemistry/Immunofluorescence: KIAA0922 Antibody [NBP2-30898] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli fibrillar center & vesicles.
![Immunohistochemistry-Paraffin: KIAA0922 Antibody [NBP2-30898] - Staining of human lymph node shows cytoplasmic positivity in germinal center cells and non-germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25324_KIAA0922-Antibody-Immunohistochemistry-Paraffin-NBP2-30898-img0005.jpg)
Immunohistochemistry-Paraffin: KIAA0922 Antibody [NBP2-30898] - Staining of human lymph node shows cytoplasmic positivity in germinal center cells and non-germinal center cells.