C11orf20 Antibody
| Name | C11orf20 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30895 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: HRAYWAEQQSRLPLPLMELMENEALEILTKALRSYQLGIGRDHFLTKELQRYIEGLKKRRSKRLYVN |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TEX40 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: C11orf20 Antibody [NBP2-30895] - Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts and Leydig cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/27071_C11orf20-Antibody-Immunohistochemistry-NBP2-30895-img0001.jpg)
Immunohistochemistry: C11orf20 Antibody [NBP2-30895] - Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts and Leydig cells.