Uridine Phosphorylase 1/UPP1 Antibody
| Name | Uridine Phosphorylase 1/UPP1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30852 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: TGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Uridine Phosphorylase 1/UPP1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | UPP1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Uridine Phosphorylase 1/UPP1 Antibody [NBP2-30852] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10424_Uridine%2520Phosphorylase%25201-UPP1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30852-img0004.jpg)
Immunocytochemistry/Immunofluorescence: Uridine Phosphorylase 1/UPP1 Antibody [NBP2-30852] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
![Immunohistochemistry-Paraffin: Uridine Phosphorylase 1/UPP1 Antibody [NBP2-30852] - Staining of human esophagus shows cytoplasmic positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10425_Uridine-Phosphorylase-1-UPP1-Antibody-Immunohistochemistry-Paraffin-NBP2-30852-img0003.jpg)
Immunohistochemistry-Paraffin: Uridine Phosphorylase 1/UPP1 Antibody [NBP2-30852] - Staining of human esophagus shows cytoplasmic positivity in squamous epithelial cells.