GEM Interacting Protein Antibody
| Name | GEM Interacting Protein Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30827 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: AQLVEFLIVHYEQIFGMDELPQATEPPPQDSSPAPGPLTTSSQPPPPHLDPDSQPPVLASDPGPDPQHHSTLEQHPTATPTEIPTPQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | GEM Interacting Protein Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | GMIP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: GEM Interacting Protein Antibody [NBP2-30827] - Staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11141_GEM-Interacting-Protein-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30827-img0002.jpg)
Immunocytochemistry/Immunofluorescence: GEM Interacting Protein Antibody [NBP2-30827] - Staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol.
![Immunohistochemistry: GEM Interacting Protein Antibody [NBP2-30827] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11142_GEM-Interacting-Protein-Antibody-Immunohistochemistry-NBP2-30827-img0001.jpg)
Immunohistochemistry: GEM Interacting Protein Antibody [NBP2-30827] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells.