GALP Antibody
| Name | GALP Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30821 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: GYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKPEIGDLGMLSMKIPKE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | GALP Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | GALP |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: GALP Antibody [NBP2-30821] - Immunohistochemical staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/27110_GALP-Antibody-Immunohistochemistry-NBP2-30821-img0001.jpg)
Immunohistochemistry: GALP Antibody [NBP2-30821] - Immunohistochemical staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.