Keratin 26 Antibody
| Name | Keratin 26 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30796 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: DIYCNLLDGEERKSKSTCYKSKGYRPVNSGNQAKDSTEETIVK |
| Description | Rabbit Polyclonal |
| Gene | KRT26 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: Keratin 26 Antibody [NBP2-30796] - Immunohistochemical staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/27123_Keratin-26-Antibody-Immunohistochemistry-NBP2-30796-img0001.jpg)
Immunohistochemistry: Keratin 26 Antibody [NBP2-30796] - Immunohistochemical staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.