FLJ23584 Antibody
| Name | FLJ23584 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31018 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: VHTHSEPIFCTTSISNTCLLPQNSSWKAWQVPWCLHDGQTRPALDMCQEMEQLLLHSQERLVSLEPVISVRSRPTSMTLTTSLPNL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FLJ23584 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | C22orf46 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: FLJ23584 Antibody [NBP2-31018] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9798_FLJ23584%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-31018-img0003.jpg)
Immunocytochemistry/Immunofluorescence: FLJ23584 Antibody [NBP2-31018] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.
![Immunohistochemistry: FLJ23584 Antibody [NBP2-31018] - Staining of human cerebellum shows moderate nuclear positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9799_FLJ23584-Antibody-Immunohistochemistry-NBP2-31018-img0001.jpg)
Immunohistochemistry: FLJ23584 Antibody [NBP2-31018] - Staining of human cerebellum shows moderate nuclear positivity in Purkinje cells.