DEFB112 Antibody
| Name | DEFB112 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31017 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: TAIGGRCKNQCDDSEFRISYCARPTTHCCVTECDPTDPNNWIPKDSVGTQEWYPKDSR |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | DEFB112 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: DEFB112 Antibody [NBP2-31017] - Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in subset of glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/27155_DEFB112-Antibody-Immunohistochemistry-NBP2-31017-img0001.jpg)
Immunohistochemistry: DEFB112 Antibody [NBP2-31017] - Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in subset of glandular cells.