PPP1R35 Antibody
| Name | PPP1R35 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30996 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: NAALREKLALLPPQARAPHPKEPPGPGPDMTILCDPETLFYESPHLTLDGLPPLRLQLRPRPSEDTFLMHRTLRRWEA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PPP1R35 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PPP1R35 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: PPP1R35 Antibody [NBP2-30996] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/841_PPP1R35-Antibody-Immunohistochemistry-NBP2-30996-img0001.jpg)
Immunohistochemistry: PPP1R35 Antibody [NBP2-30996] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.