SLC16A9 Antibody
| Name | SLC16A9 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31030 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LQSSDCPLPKKIAPEDLPDKYSIYNEKGKNLEENINILDKSYSSEEKCRITLANGDWKQDSLLHK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SLC16A9 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SLC16A9 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SLC16A9 Antibody [NBP2-31030] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26775_SLC16A9%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-31030-img0004.jpg)
Immunocytochemistry/Immunofluorescence: SLC16A9 Antibody [NBP2-31030] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleus.
![Immunohistochemistry-Paraffin: SLC16A9 Antibody [NBP2-31030] - Staining of human adrenal gland shows moderate cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26776_SLC16A9-Antibody-Immunohistochemistry-Paraffin-NBP2-31030-img0003.jpg)
Immunohistochemistry-Paraffin: SLC16A9 Antibody [NBP2-31030] - Staining of human adrenal gland shows moderate cytoplasmic positivity in glandular cells.
![Immunohistochemistry: SLC16A9 Antibody [NBP2-31030] - Staining of human rectum shows moderate membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26777_SLC16A9-Antibody-Immunohistochemistry-NBP2-31030-img0001.jpg)
Immunohistochemistry: SLC16A9 Antibody [NBP2-31030] - Staining of human rectum shows moderate membranous positivity in glandular cells.