ODF3L1 Antibody

Name ODF3L1 Antibody
Supplier Novus Biologicals
Catalog NBP1-56392
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ODF3L1(outer dense fiber of sperm tails 3-like 1) The peptide sequence was selected from the N terminal of ODF3L1. Peptide sequence KLPKGTRSSVYFAQHPEKEPLPSRQEVKQTPVIMAKIKGPGPAKYLRPSC.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ODF3L1
Conjugate Unconjugated
Supplier Page Shop

Product images