TPD52L3/D55 Antibody

Name TPD52L3/D55 Antibody
Supplier Novus Biologicals
Catalog NBP1-56498
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TPD52L3(tumor protein D52-like 3) The peptide sequence was selected from the middle region of TPD52L3. Peptide sequence GLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TPD52L3
Conjugate Unconjugated
Supplier Page Shop

Product images