RTP4 Antibody

Name RTP4 Antibody
Supplier Novus Biologicals
Catalog NBP1-56448
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RTP4 (receptor (chemosensory) transporter protein 4) The peptide sequence was selected from the middle region of RTP4)(50ug). Peptide sequence SSDSTMRILSNLVQHILKKYYGNGTRKSPEMPVILEVSLEGSHDTANCEA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RTP4
Conjugate Unconjugated
Supplier Page Shop

Product images