GSG1 Antibody

Name GSG1 Antibody
Supplier Novus Biologicals
Catalog NBP1-56435
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to GSG1(germ cell associated 1) The peptide sequence was selected from the N terminal of GSG1. Peptide sequence NYWFVGTQKVPKPLCEKGLAAKCFDMPVSLDGDTNTSTQEVVQYNWETGD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene GSG1
Conjugate Unconjugated
Supplier Page Shop

Product images