PRAMEF10 Antibody

Name PRAMEF10 Antibody
Supplier Novus Biologicals
Catalog NBP1-56432
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PRAMEF10(PRAME family member 10) The peptide sequence was selected from the middle region of PRAMEF10. Peptide sequence DLLRHTGGLSKLGLELYPAPLESLDYKGHVNWEILTPIRAELMRTLREVR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PRAMEF10
Conjugate Unconjugated
Supplier Page Shop

Product images