PSG6 Antibody

Name PSG6 Antibody
Supplier Novus Biologicals
Catalog NBP1-56485
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PSG6(pregnancy specific beta-1-glycoprotein 6) The peptide sequence was selected from the N terminal of PSG6. Peptide sequence VLLLVHNLPQNLTGYIWYKGQMTDLYHYITSYVVHGQIIYGPAYSGRETV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PSG6
Conjugate Unconjugated
Supplier Page Shop

Product images