Name | PSG6 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-56485 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to PSG6(pregnancy specific beta-1-glycoprotein 6) The peptide sequence was selected from the N terminal of PSG6. Peptide sequence VLLLVHNLPQNLTGYIWYKGQMTDLYHYITSYVVHGQIIYGPAYSGRETV. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | PSG6 |
Conjugate | Unconjugated |
Supplier Page | Shop |