PPPDE2 Antibody

Name PPPDE2 Antibody
Supplier Novus Biologicals
Catalog NBP1-56495
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to D15WSU75E The peptide sequence was selected from the middle region of D15WSU75E (NP_056519). Peptide sequence FLTGRKIPSYITDLPSEVLSTPFGQALRPLLDSIQIQPPGGSSVGRPNGQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DESI1
Conjugate Unconjugated
Supplier Page Shop

Product images