QRSL Antibody

Name QRSL Antibody
Supplier Novus Biologicals
Catalog NBP1-56621
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to QRSL1(glutaminyl-tRNA synthase (glutamine-hydrolyzing)-like 1) The peptide sequence was selected from the N terminal of QRSL1. Peptide sequence SYSKQYREKRKQNPHSENEDSDWLITGGSSGGSAAAVSAFTCYAALGSDT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene QRSL1
Conjugate Unconjugated
Supplier Page Shop

Product images