LETM2 Antibody

Name LETM2 Antibody
Supplier Novus Biologicals
Catalog NBP1-56618
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LETM2(leucine zipper-EF-hand containing transmembrane protein 2) The peptide sequence was selected from the N terminal of LETM2. Peptide sequence KNYESKKYSDPSQPGNTVLHPGTRLIQKLHTSTCWLQEVPGKPQLEQATK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LETM2
Conjugate Unconjugated
Supplier Page Shop

Product images