SPACA7 Antibody

Name SPACA7 Antibody
Supplier Novus Biologicals
Catalog NBP1-56568
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C13ORF28 The peptide sequence was selected from the middle region of C13orf28. Peptide sequence PGIEDKISNDEANANANLHGDPSENYRGPQVSPGSEKSVSSKEKNSKNTQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SPACA7
Conjugate Unconjugated
Supplier Page Shop

Product images