NECAB3 Antibody

Name NECAB3 Antibody
Supplier Novus Biologicals
Catalog NBP1-56551
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NECAB3 (N-terminal EF-hand calcium binding protein 3) The peptide sequence was selected from the N terminal of NECAB3)(50ug). Peptide sequence MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene NECAB3
Conjugate Unconjugated
Supplier Page Shop

Product images