CCDC138 Antibody

Name CCDC138 Antibody
Supplier Novus Biologicals
Catalog NBP1-56597
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CCDC138(coiled-coil domain containing 138) The peptide sequence was selected from the N terminal of CCDC138. Peptide sequence EPRVVKPPGQDLVVESLKSRYGLGGSCPDEYDFSNFYQSKYKRRTLTSPG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CCDC138
Conjugate Unconjugated
Supplier Page Shop

Product images