IFLTD1 Antibody

Name IFLTD1 Antibody
Supplier Novus Biologicals
Catalog NBP1-56726
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to IFLTD1(intermediate filament tail domain containing 1) The peptide sequence was selected from the middle region of IFLTD1. Peptide sequence PPTVFPNRSPWCQNPYVSAHPYCPLIEPHNTSTAGGRLDRQPRSRSTRPN.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LMNTD1
Conjugate Unconjugated
Supplier Page Shop

Product images