FAM81B Antibody

Name FAM81B Antibody
Supplier Novus Biologicals
Catalog NBP1-56724
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FAM81B(family with sequence similarity 81, member B) The peptide sequence was selected from the N terminal of FAM81B. Peptide sequence MQLQFLGTLASSEKRKKSQRLFFKNIKSTKNKAGKASIMSSDTNVNKSAS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FAM81B
Conjugate Unconjugated
Supplier Page Shop

Product images