CCDC151 Antibody
| Name | CCDC151 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56716 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to MGC20983 The peptide sequence was selected from the middle region of MGC20983. Peptide sequence IALPLATSKDKFFDEESEEEDNEVVTRASLKIRSQKLIESHKKHRRSRRS. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CCDC151 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CCDC151 Antibody [NBP1-56716] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15948_CCDC151-Antibody-Western-Blot-NBP1-56716-img0004.jpg)
Western Blot: CCDC151 Antibody [NBP1-56716] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.