C5orf35 Antibody

Name C5orf35 Antibody
Supplier Novus Biologicals
Catalog NBP1-56742
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C5ORF35 The peptide sequence was selected from the N terminal of C5ORF35. Peptide sequence QSEILTMLPESVKSKYQDLLAVEHQGVKLRENRHQQQSTFKPEEILYKTL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SETD9
Conjugate Unconjugated
Supplier Page Shop

Product images