TRIML2 Antibody

Name TRIML2 Antibody
Supplier Novus Biologicals
Catalog NBP1-56794
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TRIML2(tripartite motif family-like 2) The peptide sequence was selected from the middle region of TRIML2. Peptide sequence SEDLRTMRLRHGQQDGAGNPERLDFSAMVLAAESFTSGRHYWEVDVEKAT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TRIML2
Conjugate Unconjugated
Supplier Page Shop

Product images