YF5 Antibody
| Name | YF5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56908 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to C21ORF2 The peptide sequence was selected from the N terminal of C21ORF2. Peptide sequence KLTRKMVLTRAKASELHSVRKLNCWGSRLTDISICQEMPSLEVITLSVNS. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | C21orf2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: YF5 Antibody [NBP1-56908] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:1562500 Positive Control: 293T cell lysate There is BioGPS gene expression data showing that C21orf2 is expressed in HEK293T](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7210_YF5-Antibody-Western-Blot-NBP1-56908-img0004.jpg)
Western Blot: YF5 Antibody [NBP1-56908] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:1562500 Positive Control: 293T cell lysate There is BioGPS gene expression data showing that C21orf2 is expressed in HEK293T
![Western Blot: YF5 Antibody [NBP1-56908] - Reccomended Titration: 5% Milk ELISA Titer: dilution: 1:500 Positive Control: human LCL](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7211_YF5%2520Antibody-Western%2520Blot-NBP1-56908-img0005.jpg)
Western Blot: YF5 Antibody [NBP1-56908] - Reccomended Titration: 5% Milk ELISA Titer: dilution: 1:500 Positive Control: human LCL