C18orf32 Antibody

Name C18orf32 Antibody
Supplier Novus Biologicals
Catalog NBP1-56827
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C18ORF32 The peptide sequence was selected from the middle region of C18ORF32. Peptide sequence PLVSPFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEICDKKK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene C18orf32
Conjugate Unconjugated
Supplier Page Shop

Product images