DDI1 Antibody

Name DDI1 Antibody
Supplier Novus Biologicals
Catalog NBP1-56817
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to DDI1(DDI1, DNA-damage inducible 1, homolog 1 (S. cerevisiae)) The peptide sequence was selected from the middle region of DDI1. Peptide sequence KNVLVIGTTGTQTYFLPEGELPLCSRMVSGQDESSDKEITHSVMDSGRKE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DDI1
Conjugate Unconjugated
Supplier Page Shop

Product images