Name | DDI1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-56817 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to DDI1(DDI1, DNA-damage inducible 1, homolog 1 (S. cerevisiae)) The peptide sequence was selected from the middle region of DDI1. Peptide sequence KNVLVIGTTGTQTYFLPEGELPLCSRMVSGQDESSDKEITHSVMDSGRKE. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | DDI1 |
Conjugate | Unconjugated |
Supplier Page | Shop |