C17orf82 Antibody
| Name | C17orf82 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56810 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to C17ORF82 The peptide sequence was selected from the N terminal of C17ORF82. Peptide sequence MGRPLEGQPLRALDLYPEPAFLRSGKDPKSSPASSPSFAVLGPEVRSTGG. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | C17orf82 |
| Supplier Page | Shop |
Product images
![Western Blot: C17orf82 Antibody [NBP1-56810] - LN18 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/45_C17orf82%2520Antibody-Western%2520Blot-NBP1-56810-img0002.jpg)
Western Blot: C17orf82 Antibody [NBP1-56810] - LN18 cell lysate, concentration 0.2-1 ug/ml.