ZCCHC13 Antibody

Name ZCCHC13 Antibody
Supplier Novus Biologicals
Catalog NBP1-56809
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ZCCHC13(zinc finger, CCHC domain containing 13) The peptide sequence was selected from the middle region of ZCCHC13. Peptide sequence GKLGHIQKDCAQVKCYRCGEIGHVAINCSKARPGQLLPLRQIPTSSQGMS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ZCCHC13
Conjugate Unconjugated
Supplier Page Shop

Product images