IF3EI Antibody

Name IF3EI Antibody
Supplier Novus Biologicals
Catalog NBP1-56926
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to EIF3EIP(eukaryotic translation initiation factor 3, subunit E interacting protein) The peptide sequence was selected from the N terminal of EIF3EIP. Peptide sequence SYPADDYESEAAYDPYAYPSDYDMHTGDPKQDLAYER
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene EIF3L
Conjugate Unconjugated
Supplier Page Shop

Product images