CCDC87 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-56880
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to CCDC87(coiled-coil domain containing 87) The peptide sequence was selected from the N terminal of CCDC87. Peptide sequence MMEPPKPEPELQRFYHRLLRPLSLFPTRTTSPEPQKRPPQEGRILQSFPL.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: CCDC87
• Conjugate: Unconjugated

Product images

Western Blot: CCDC87 Antibody [NBP1-56880] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.