ABC2 Antibody
| Name | ABC2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56876 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to C17ORF71 The peptide sequence was selected from the middle region of C17ORF71 (NP_060619). Peptide sequence HCVHKFHSLPKSGEKPEADRNPPVLYHNSRARSTGACNCGRKQAPRDDPF. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SMG8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ABC2 Antibody [NBP1-56876] - Sample Type: Human Fetal Lung Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19909_ABC2-Antibody-Western-Blot-NBP1-56876-img0008.jpg)
Western Blot: ABC2 Antibody [NBP1-56876] - Sample Type: Human Fetal Lung Antibody Dilution: 1.0 ug/ml
![Western Blot: ABC2 Antibody [NBP1-56876] - 721_B cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19910_ABC2-Antibody-Western-Blot-NBP1-56876-img0002.jpg)
Western Blot: ABC2 Antibody [NBP1-56876] - 721_B cell lysate, concentration 0.2-1 ug/ml.
![Western Blot: ABC2 Antibody [NBP1-56876] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19911_ABC2-Antibody-Western-Blot-NBP1-56876-img0004.jpg)
Western Blot: ABC2 Antibody [NBP1-56876] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.
![Western Blot: ABC2 Antibody [NBP1-56876] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19912_ABC2-Antibody-Western-Blot-NBP1-56876-img0005.jpg)
Western Blot: ABC2 Antibody [NBP1-56876] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
![Western Blot: ABC2 Antibody [NBP1-56876] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19913_ABC2-Antibody-Western-Blot-NBP1-56876-img0006.jpg)
Western Blot: ABC2 Antibody [NBP1-56876] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
![Western Blot: ABC2 Antibody [NBP1-56876] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19914_ABC2-Antibody-Western-Blot-NBP1-56876-img0007.jpg)
Western Blot: ABC2 Antibody [NBP1-56876] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml