FAM90A1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-56875
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to FAM90A1(family with sequence similarity 90, member A1) The peptide sequence was selected from the N terminal of FAM90A1. Peptide sequence PDEEDPRLKCKNCEAFGHTARSTRCPMKCWKAALVPPNFGEKEGKENLKP.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: FAM90A1
• Conjugate: Unconjugated