Name | PGBD3 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57283 |
Prices | $139.00, $299.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to PGBD3 (piggyBac transposable element derived 3) The peptide sequence was selected from the N terminal of PGBD3. Peptide sequence NLPGSLLHTAAYLIQDGSDAESDSDDPSYAPKDDSPDEVPSTFTVQQPPP. |
Purity/Format | Protein A purified |
Description | Rabbit Polyclonal |
Gene | PGBD3 |
Conjugate | Unconjugated |
Supplier Page | Shop |