DAZ3 Antibody

Name DAZ3 Antibody
Supplier Novus Biologicals
Catalog NBP1-57409
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to DAZ3(deleted in azoospermia 3) The peptide sequence was selected from the middle region of DAZ3. Peptide sequence PFPAYPRSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAF.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DAZ3
Conjugate Unconjugated
Supplier Page Shop

Product images