BRUNOL5 Antibody

Name BRUNOL5 Antibody
Supplier Novus Biologicals
Catalog NBP1-57522
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to BRUNOL5 (CUGBP, Elav-like family member 5) The peptide sequence was selected from the middle region of BRUNOL5)(50ug). Peptide sequence AFSGVQQYTAMYPTAAITPIAHSVPQPPPLLQQQQREGPEGCNLFIYHLP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CELF5
Conjugate Unconjugated
Supplier Page Shop

Product images